PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g046820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 725aa    MW: 78396.8 Da    PI: 5.9448
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g046820.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.52.8e-13230291162
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv +L +  ++L  +++    e a+l+++
  Csa06g046820.1 230 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNLHSTITDLNGKMSYVMAENATLRQQ 291
                     678899**************************************999999999999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-15230294IPR004827Basic-leucine zipper domain
PfamPF001703.5E-11231292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.484232292IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-16234293No hitNo description
SuperFamilySSF579591.48E-11234292No hitNo description
CDDcd147042.97E-21235286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MAEPITEQPP PPAPDPNSTH PPPSDFDSIS IPPFDDHFGS DQTPIGELMS DLGFPDGEFE  60
LTFDGMDDLY FPAENESFLI PVNASTQEHF GDFTPDSEAS GISGGSLLLP TKDDAVTTSG  120
CCNRESPRDD SDDRCSGADR SLDLPTPLSS QGSGNCGSDV SEATNESSPK SGNVVVDQKV  180
KVEEAVATTT TTSIITKRKK EIEEDLSDES RNSKYRRSGE DADASAVTGE EDEKKKARLM  240
RNRESAQLSR QRKKHYVEEL EEKVRNLHST ITDLNGKMSY VMAENATLRQ QLGANGMCPP  300
HHPPPPMGMY PPMAPMPYPW MPCPPYIVKQ QGSQVPLIPI PRLKPQNPLG TSKAKKSESK  360
KSEAKTKKVA SISFLGLLFC LFLFGALAPI VNVNYGGISG AFYGNYRSNY ITDQIYSQHR  420
DRVLDASRSG AGTGVSNSNG IHCGRDSDQG TRKNISATES SVPPGNGSEP LVASLFVPRN  480
DKLVKIDGNL IINSILASEK AVASRKASES NERNADLVIP KDYSPALPLP DVGRTEEMAK  540
HLYRSKTEKQ KALSSGSADT LKDQFKTKAA NGEMQQWFRE GVAGPMFSSG MCTEVFQFDV  600
SSTSGAIIPA TNVSAEHVKN TTDTHKRKNR RILRGLPIPL PGSDFNLTKE HQRNSSSKEI  660
KPASSVVVSV LVDPREGGDG DIEGMIGGPK SLSRVFVVVL LDSAKYVTYS CVLPRSGAPH  720
LVTT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010517576.10.0PREDICTED: uncharacterized protein LOC104793002
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLD7LGH50.0D7LGH5_ARALL; BZIP transcription factor family protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein